Conger conger (European conger): 133110058 Help Entry 133110058         CDS       T10633                                  Name (RefSeq) ADP-ribosylation factor 4-like   KO K07939   ADP-ribosylation factor 4 Organism ccog  Conger conger (European conger) Pathway ccog04144   Endocytosis Brite KEGG Orthology (KO) [BR:ccog00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133110058  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccog04131]     133110058   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccog04147]     133110058    04031 GTP-binding proteins [BR:ccog04031]     133110058 Membrane trafficking [BR:ccog04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     133110058 Exosome [BR:ccog04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133110058   Exosomal proteins of other body fluids (saliva and urine)    133110058   Exosomal proteins of colorectal cancer cells    133110058 GTP-binding proteins [BR:ccog04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     133110058 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras Gtr1_RagA SRPRB FLAD1_M Csa3_N GTP_EFTU cobW CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  133110058 NCBI-ProteinID:  XP_061075909 LinkDB All DBs Position 14:complement(1849445..1855313) Genome browser AA seq 134 aa AA seqDB search MSGFNGETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERTQEAAEEL QKMLQEDELADAVLLVFANKQDLPNAMPMSEMTEKLALQSLRNRKWYVQATCATQGSGLY EGLDWLSTQLSSKS NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgtctgggttcaacggggagaccgtagaatacaagaacatctgcttcacggtgtgggac gtgggaggccaggacaagatcagacctctctggaggcactacttccaaaacactcagggt ctcatctttgtggtggacagcaacgaccgcgagcgcacacaggaggctgctgaggaactg cagaagatgctgcaggaggatgagctggccgacgccgtgctgctggtgtttgccaacaaa caggacctgcccaacgccatgcccatgagcgaaatgactgagaaactggccctgcagtca ttgaggaacagaaaatggtacgtccaggccacctgtgccactcagggatcgggcctgtac gagggtctggactggctgtccacccagctcagtagcaagagctag

DBGET integrated database retrieval system