Conger conger (European conger): 133110227 Help Entry 133110227         CDS       T10633                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ccog  Conger conger (European conger) Pathway ccog04810   Regulation of actin cytoskeleton ccog05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccog00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     133110227 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133110227 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  133110227 NCBI-ProteinID:  XP_061076157 LinkDB All DBs Position 14:14812638..14814594 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggccaggaagacccagtgcagagggagattcatcaagactgggcaaatcgagaa tatatcgaagttattacgagcagcatcaagaagattgcagatttcctcaattcttttgat atgtcctgccgttcccgcttggcgactctgaatgagaaattgactgcgttagaaaggaga atcgagtacatagaggcaagggtgacgaaaggggagacgttgacttaa

DBGET integrated database retrieval system