Conger conger (European conger): 133115437 Help Entry 133115437         CDS       T10633                                  Name (RefSeq) insulin   KO K04526   insulin Organism ccog  Conger conger (European conger) Pathway ccog04010   MAPK signaling pathway ccog04068   FoxO signaling pathway ccog04081   Hormone signaling ccog04114   Oocyte meiosis ccog04140   Autophagy - animal ccog04150   mTOR signaling pathway ccog04810   Regulation of actin cytoskeleton ccog04910   Insulin signaling pathway ccog04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ccog00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133115437    04068 FoxO signaling pathway     133115437    04150 mTOR signaling pathway     133115437   09133 Signaling molecules and interaction    04081 Hormone signaling     133115437  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133115437   09143 Cell growth and death    04114 Oocyte meiosis     133115437   09142 Cell motility    04810 Regulation of actin cytoskeleton     133115437  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     133115437    04914 Progesterone-mediated oocyte maturation     133115437  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccog04052]     133115437 Cytokines and neuropeptides [BR:ccog04052]  Neuropeptides   Unclassified    133115437 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  133115437 NCBI-ProteinID:  XP_061081336 LinkDB All DBs Position 16 Genome browser AA seq 115 aa AA seqDB search MRLDRLGLLALCLLWVAPPCGAFGNRRLCGIQLVEALLFVCGEKGLFYHPGRRGREENTR IMMRDSASFLREARMILGSGEGARLSRNGVTKRGIVEQCCHFYCDYYDLENYCNI NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgcgcttagaccgcctcggcctcctggcgctgtgcctgctgtgggtggcgccaccgtgt ggcgctttcgggaatcgccggctgtgcggcattcagctcgtggaagcgctgctgtttgtc tgcggcgagaaagggctcttctaccatcccgggagaagagggagagaggaaaatacacga atcatgatgagggacagcgcctcctttctgcgggaggccagaatgatccttgggagcgga gagggggcgaggttgagccgtaatggcgtcaccaagagagggattgtggagcagtgctgc cacttctactgcgattactacgacctggagaactactgcaacatataa

DBGET integrated database retrieval system