Conger conger (European conger): 133121463 Help Entry 133121463         CDS       T10633                                  Symbol bbip1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism ccog  Conger conger (European conger) Brite Cilium and associated proteins [BR:ccog03037]  Primary cilia and associated proteins   BBSome    133121463 (bbip1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  133121463 NCBI-ProteinID:  XP_061086613 LinkDB All DBs Position 2:19159085..19165526 Genome browser AA seq 69 aa AA seqDB search MPEVKSMFREVLPKQGQLSMEDVPTMVLCKPKLLPLKSVTLEKLEKMQQEAQEAIRLQEL AQKDRPESL NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcctgaagtaaagtcaatgttcagagaagtgcttcccaaacaagggcagctgtcgatg gaggacgtgcccacaatggtgctttgtaagccgaagctgctgcctctgaaatcagtcacc ttggagaaactagagaagatgcagcaggaggcacaagaagcaattcggctgcaggaactg gcccagaaggacaggccagagtcactgtag

DBGET integrated database retrieval system