Conger conger (European conger): 133121564 Help Entry 133121564         CDS       T10633                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ccog  Conger conger (European conger) Pathway ccog04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ccog00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     133121564  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccog04121]     133121564    03400 DNA repair and recombination proteins [BR:ccog03400]     133121564 Ubiquitin system [BR:ccog04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      133121564    Cul5 complex      133121564 DNA repair and recombination proteins [BR:ccog03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      133121564 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  133121564 NCBI-ProteinID:  XP_061086815 LinkDB All DBs Position 2 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLFKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEVFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctcatgattcggcgccacaaaacgaccatctttactgatgccaaggag tctaccactgtttatgagctgaagcgcattgtggaggggatcctgaaaagggcaccagag gagcagagactcttcaaggatgatcagttgttagaggacagtaaaactcttggggactgt gggttcactaatcagactgcaagacctcaggccccagccactgtagggctagcttttcgc atcaatgatgaggtgtttgagcagctgcgggtagaaccattctccagcccccctgagctc ccagacgtaatgaagccccaggactctggcagcactgctaacgagcaggccgtccagtga

DBGET integrated database retrieval system