Conger conger (European conger): 133124930 Help Entry 133124930         CDS       T10633                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism ccog  Conger conger (European conger) Pathway ccog04010   MAPK signaling pathway ccog04144   Endocytosis ccog04370   VEGF signaling pathway ccog04510   Focal adhesion ccog04517   IgSF CAM signaling ccog04518   Integrin signaling ccog04520   Adherens junction ccog04530   Tight junction ccog04810   Regulation of actin cytoskeleton ccog04912   GnRH signaling pathway ccog05100   Bacterial invasion of epithelial cells ccog05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccog00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133124930 (cdc42l)    04370 VEGF signaling pathway     133124930 (cdc42l)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133124930 (cdc42l)    04518 Integrin signaling     133124930 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133124930 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     133124930 (cdc42l)    04520 Adherens junction     133124930 (cdc42l)    04530 Tight junction     133124930 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133124930 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     133124930 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133124930 (cdc42l)    05100 Bacterial invasion of epithelial cells     133124930 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccog04131]     133124930 (cdc42l)    03036 Chromosome and associated proteins [BR:ccog03036]     133124930 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccog04147]     133124930 (cdc42l)    04031 GTP-binding proteins [BR:ccog04031]     133124930 (cdc42l) Membrane trafficking [BR:ccog04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133124930 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     133124930 (cdc42l)   Macropinocytosis    Ras GTPases     133124930 (cdc42l) Chromosome and associated proteins [BR:ccog03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     133124930 (cdc42l) Exosome [BR:ccog04147]  Exosomal proteins   Exosomal proteins of microglial cells    133124930 (cdc42l)   Exosomal proteins of breast milk    133124930 (cdc42l) GTP-binding proteins [BR:ccog04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133124930 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  133124930 NCBI-ProteinID:  XP_061092506 LinkDB All DBs Position 1:complement(78922311..78929613) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSCENVREKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVDKLAKNKQRPLLPESGDKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCALL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggttgtgggggatggtgctgtggggaagacctgcctactg atctcctatacaaccaacaagttcccctctgaatatgtgccaacggtgtttgataactac gcagtcacagtgatgatcggtggggagccctacacactcggcctgttcgacactgcagga caggaagactacgacaggctgcggcccctcagctatccccagacggacgtgttcctggtc tgcttctccgtcgtatcgccctcctcctgtgagaatgttcgggaaaagtgggtccctgag atctcccaccactgcccccgcacccccttcctgctggtgggcacgcaggtggacctgcgc gacgacagcaacacggtggacaagctggccaagaacaaacagcgccccctgctgcccgag agcggcgacaagctggcgcgggagctccgcgcggtcaagtatgtggaatgctctgccctg acgcagcgaggcctgaagaatgtgttcgacgaggctatcctagctgctctggagcccccc gagaccaagcccaagaagcgctgcgctctgctatag

DBGET integrated database retrieval system