Conger conger (European conger): 133130374 Help Entry 133130374         CDS       T10633                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism ccog  Conger conger (European conger) Pathway ccog04010   MAPK signaling pathway ccog04012   ErbB signaling pathway ccog04068   FoxO signaling pathway ccog04137   Mitophagy - animal ccog04140   Autophagy - animal ccog04144   Endocytosis ccog04150   mTOR signaling pathway ccog04210   Apoptosis ccog04218   Cellular senescence ccog04370   VEGF signaling pathway ccog04371   Apelin signaling pathway ccog04510   Focal adhesion ccog04540   Gap junction ccog04625   C-type lectin receptor signaling pathway ccog04810   Regulation of actin cytoskeleton ccog04910   Insulin signaling pathway ccog04912   GnRH signaling pathway ccog04916   Melanogenesis ccog05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccog00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133130374    04012 ErbB signaling pathway     133130374    04370 VEGF signaling pathway     133130374    04371 Apelin signaling pathway     133130374    04068 FoxO signaling pathway     133130374    04150 mTOR signaling pathway     133130374  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133130374    04140 Autophagy - animal     133130374    04137 Mitophagy - animal     133130374   09143 Cell growth and death    04210 Apoptosis     133130374    04218 Cellular senescence     133130374   09144 Cellular community - eukaryotes    04510 Focal adhesion     133130374    04540 Gap junction     133130374   09142 Cell motility    04810 Regulation of actin cytoskeleton     133130374  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     133130374   09152 Endocrine system    04910 Insulin signaling pathway     133130374    04912 GnRH signaling pathway     133130374    04916 Melanogenesis     133130374  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133130374  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccog04131]     133130374   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccog04147]     133130374    04031 GTP-binding proteins [BR:ccog04031]     133130374 Membrane trafficking [BR:ccog04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     133130374  Endocytosis   Macropinocytosis    Ras GTPases     133130374 Exosome [BR:ccog04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    133130374   Exosomal proteins of colorectal cancer cells    133130374 GTP-binding proteins [BR:ccog04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     133130374 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  133130374 NCBI-ProteinID:  XP_061100912 LinkDB All DBs Position 6:11761467..11767213 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQDLARSYGIPCIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggttggagcaggtggtgtggggaagagtgcactcact atccagctcatccagaaccactttgtggatgagtatgaccccacaattgaggactcctac aggaagcaggtggtgattgacggagagacgtgcctgctggacatcctggacacagcgggc caggaggagtacagcgccatgcgggaccagtatatgaggactggggaaggcttcctctgt gtctttgccattaacaacaccaagtcctttgaggacattcaccagtacagagagcagatc aaacgggtgaaggactctgatgatgtgcccatggtgctggtgggtaataagtgtgacctc ccggctcgcaccgtggacacacgacaagcgcaggatctggcccgcagctacggaatcccc tgcatagagacctcggccaaaacacggcagggagtagaggatgccttctacacgctagtc cgtgagatcaggcagcacaagctgaggaaactgaaccctcctgatgagagtggtcaggac tgcatgaattgccgctgtgtggtgtcatga

DBGET integrated database retrieval system