Conger conger (European conger): 133130874 Help Entry 133130874         CDS       T10633                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism ccog  Conger conger (European conger) Pathway ccog03030   DNA replication ccog03410   Base excision repair ccog03420   Nucleotide excision repair ccog03430   Mismatch repair ccog03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ccog00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     133130874 (pold4)    03410 Base excision repair     133130874 (pold4)    03420 Nucleotide excision repair     133130874 (pold4)    03430 Mismatch repair     133130874 (pold4)    03440 Homologous recombination     133130874 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccog03032]     133130874 (pold4)    03400 DNA repair and recombination proteins [BR:ccog03400]     133130874 (pold4) DNA replication proteins [BR:ccog03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     133130874 (pold4) DNA repair and recombination proteins [BR:ccog03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       133130874 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      133130874 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  133130874 NCBI-ProteinID:  XP_061101806 LinkDB All DBs Position 6:1393780..1403263 Genome browser AA seq 96 aa AA seqDB search MAPKRRLITDTFKVVKRAKKKQKEDKEPAGPEKEPEPQPRPMTQRQKDLLELQQFDLDWT YGPCSGISRMQRWERAELHGLKPPQAIRDLLLRSGG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggctcccaagcgcaggctgatcacagacacctttaaggtggtgaagagagctaagaaa aaacagaaggaggacaaggagcctgcaggaccagagaaagagcccgagccccagccccgc cccatgacacagcgccagaaggacctgctggagctgcagcagtttgatctggactggacc tacgggccctgcagcggtatcagccggatgcagcgctgggagagggcggagcttcacggg ctgaagcccccacaggccatcagagacctgctgctgaggagtggagggtaa

DBGET integrated database retrieval system