Conger conger (European conger): 133130956 Help Entry 133130956         CDS       T10633                                  Name (RefSeq) C-C motif chemokine 3-like 1   KO K12964   C-C motif chemokine 4 Organism ccog  Conger conger (European conger) Pathway ccog04060   Cytokine-cytokine receptor interaction ccog04620   Toll-like receptor signaling pathway ccog04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:ccog00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     133130956  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133130956    04623 Cytosolic DNA-sensing pathway     133130956  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccog04052]     133130956 Cytokines and neuropeptides [BR:ccog04052]  Cytokines   Chemokines    133130956 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ribosomal_S19e Motif Other DBs NCBI-GeneID:  133130956 NCBI-ProteinID:  XP_061101962 LinkDB All DBs Position 6:complement(52140247..52141408) Genome browser AA seq 103 aa AA seqDB search MNPKMNLSALLIVLLFSLGLVSPAPLAISTGNTCCPSTQKAKIPLKQIVSYYKTSSSCAL PALVFVTKLGKHWCVNPADAWVKSHAAAVDRRLASTPVMSTRA NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacccaaagatgaacttgagcgccctgctgatcgtgttgctgttctctctgggcctg gtctctcctgctcctctggcaattagcacaggcaacacctgctgtccaagtacacagaag gcaaagatcccgctgaaacagatagtctcctactacaaaaccagcagcagctgcgccctg ccagctcttgtgtttgtgactaaactcggaaaacactggtgtgtgaatcccgctgatgcc tgggtgaagagccatgcagctgctgtggaccgcaggttggccagcactccagtgatgagc accagagcctaa

DBGET integrated database retrieval system