Conger conger (European conger): 133132113 Help Entry 133132113         CDS       T10633                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism ccog  Conger conger (European conger) Pathway ccog04145   Phagocytosis ccog04517   IgSF CAM signaling ccog04814   Motor proteins ccog05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccog00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133132113 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     133132113 (dynll2b)   09142 Cell motility    04814 Motor proteins     133132113 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133132113 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccog03037]     133132113 (dynll2b)    04812 Cytoskeleton proteins [BR:ccog04812]     133132113 (dynll2b) Cilium and associated proteins [BR:ccog03037]  Motile cilia and associated proteins   Dynein arm    133132113 (dynll2b) Cytoskeleton proteins [BR:ccog04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      133132113 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ectatomin NtdA_N Motif Other DBs NCBI-GeneID:  133132113 NCBI-ProteinID:  XP_061103269 LinkDB All DBs Position 7 Genome browser AA seq 89 aa AA seqDB search MADRKAVIKNADMSEDMQQDAVDCATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggctgacaggaaggctgtgatcaagaatgctgacatgtccgaggacatgcagcaggat gctgtggactgtgccacccaggccatggagaagttcaacatcgagaaagatatcgctgca tacattaagaaggagtttgacaagaagtacaatcccacatggcattgcattgtgggaagg aacttcgggagctacgtaacgcatgagacaaagcacttcatctacttctacctggggcaa gtggccatcctgctcttcaagtctggctga

DBGET integrated database retrieval system