Conger conger (European conger): 133132725 Help Entry 133132725         CDS       T10633                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism ccog  Conger conger (European conger) Pathway ccog03082   ATP-dependent chromatin remodeling ccog04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccog00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     133132725  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     133132725  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccog03036]     133132725   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccog04147]     133132725 Chromosome and associated proteins [BR:ccog03036]  Eukaryotic type   Nucleosome assembly factors    Histones     133132725 Exosome [BR:ccog04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133132725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  133132725 NCBI-ProteinID:  XP_061104373 LinkDB All DBs Position 7:34504697..34505700 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggcaggggtaaaactggtggtaaagcccgggctaaggcaaaatctcgctcttct cgtgccgggctacagttcccagtgggccgtgttcacagattgttgcgcaaaggtaactac gcagaacgagtcggtgctggggctcccgtttacctggctgccgtgttggaatatctgacc gctgagatattggaattggctggtaacgctgccagagacaacaagaagacgaggatcatc cctcgtcacctgcagctggctgtccgcaacgatgaggagctgaacaagcttttaggcggc gtaaccatcgctcaaggtggagttttacccaatatccaggctgtgctgctgcccaagaaa accgagaagccggcaaagagcaagtaa

DBGET integrated database retrieval system