Conger conger (European conger): 133135524 Help Entry 133135524         CDS       T10633                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism ccog  Conger conger (European conger) Pathway ccog04382   Cornified envelope formation ccog05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccog00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     133135524 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133135524 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccog04147]     133135524 (s100a10b) Exosome [BR:ccog04147]  Exosomal proteins   Exosomal proteins of microglial cells    133135524 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 EH Motif Other DBs NCBI-GeneID:  133135524 NCBI-ProteinID:  XP_061108572 LinkDB All DBs Position 1:76585420..76587558 Genome browser AA seq 105 aa AA seqDB search MPSDLESSMQSLITVFHKYASKDGDQYFLSRSQFRTLAESELANFLKSQKDPCAVDTIMN SLDSNRDGRVDFNEYVSLVVGLSVACEQCFQMHLKQNKPSAAAKK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgccttcagacctggaatcttccatgcagtccctgatcacagtgtttcacaaatatgca tccaaggatggcgaccagtacttcctcagccgttcccagttcaggaccctggcggagtct gaactggctaactttctcaaaagccagaaggatccctgtgcagtagacacgatcatgaac agcctggacagcaacagagatggtcgggtggacttcaatgagtatgtgtccctggtggtg ggactctccgttgcctgtgagcagtgcttccagatgcacctgaagcagaataagccctct gccgcagctaaaaagtga

DBGET integrated database retrieval system