Conger conger (European conger): 133136791 Help Entry 133136791         CDS       T10633                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism ccog  Conger conger (European conger) Pathway ccog04382   Cornified envelope formation ccog05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccog00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     133136791  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133136791  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccog04147]     133136791 Exosome [BR:ccog04147]  Exosomal proteins   Exosomal proteins of microglial cells    133136791 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 DAXX_hist_bd Motif Other DBs NCBI-GeneID:  133136791 NCBI-ProteinID:  XP_061110508 LinkDB All DBs Position 9:complement(43009583..43014341) Genome browser AA seq 97 aa AA seqDB search MPSELENAMEMLIKVFHRYASKEGDSNSLCRRELKDLMENELSSFLKTQKDPAAVDRIMK DLDANGDGEVNFEEFVNFVVALSTACANNYQMKQRVK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatcggaattggagaacgccatggagatgctcattaaggtcttccaccgctacgcg tccaaagaaggcgacagcaactccctctgccgcagggagctgaaggacctgatggagaac gagctctctagcttcctcaagactcagaaggacccggccgcagtggacaggatcatgaag gacctggacgccaacggcgacggggaagtgaactttgaggagtttgtgaactttgtggtg gccctctccactgcttgtgcaaataactaccaaatgaagcagagggtgaagtga

DBGET integrated database retrieval system