Conger conger (European conger): 133138447 Help Entry 133138447         CDS       T10633                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ccog  Conger conger (European conger) Pathway ccog04010   MAPK signaling pathway ccog04012   ErbB signaling pathway ccog04068   FoxO signaling pathway ccog04137   Mitophagy - animal ccog04140   Autophagy - animal ccog04150   mTOR signaling pathway ccog04210   Apoptosis ccog04218   Cellular senescence ccog04370   VEGF signaling pathway ccog04371   Apelin signaling pathway ccog04540   Gap junction ccog04625   C-type lectin receptor signaling pathway ccog04810   Regulation of actin cytoskeleton ccog04910   Insulin signaling pathway ccog04912   GnRH signaling pathway ccog04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ccog00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133138447 (nras)    04012 ErbB signaling pathway     133138447 (nras)    04370 VEGF signaling pathway     133138447 (nras)    04371 Apelin signaling pathway     133138447 (nras)    04068 FoxO signaling pathway     133138447 (nras)    04150 mTOR signaling pathway     133138447 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133138447 (nras)    04137 Mitophagy - animal     133138447 (nras)   09143 Cell growth and death    04210 Apoptosis     133138447 (nras)    04218 Cellular senescence     133138447 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     133138447 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133138447 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     133138447 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     133138447 (nras)    04912 GnRH signaling pathway     133138447 (nras)    04916 Melanogenesis     133138447 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccog04131]     133138447 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccog04147]     133138447 (nras)    04031 GTP-binding proteins [BR:ccog04031]     133138447 (nras) Membrane trafficking [BR:ccog04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     133138447 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     133138447 (nras) Exosome [BR:ccog04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133138447 (nras)   Exosomal proteins of other body fluids (saliva and urine)    133138447 (nras)   Exosomal proteins of breast cancer cells    133138447 (nras)   Exosomal proteins of colorectal cancer cells    133138447 (nras) GTP-binding proteins [BR:ccog04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     133138447 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  133138447 NCBI-ProteinID:  XP_061113205 LinkDB All DBs Position 10:complement(38971418..38982837) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAVNNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL VRTVDTKQAQELARNYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCSVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagctggtggtggtgggagctggtggtgtggggaagagtgcgctgacc atccagctcatccagaaccactttgtggacgagtacgatcccaccatcgaggactcgtac aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacacggcaggt caggaggagtacagcgccatgcgcgaccagtacatgaggaccggagagggcttcctctgc gtgttcgccgtcaacaacagcaagtccttcgccgacgtgcatttatacagggaacagatc aagcgagtgaaggactcggatgatgttcccatggtgctagtgggaaacaagtgtgacctg gttcggaccgtggacaccaaacaggcccaggagctggcgcggaactacggcatcgagttc gtggagacctcggccaagaccagacagggagtggaggatgccttctacacgctggtgcgg gagattcgccactaccgcatgaagaagctcaacagcagagaggacaggaagcagggctgc ttgggtgtttcctgttcagtcatgtga

DBGET integrated database retrieval system