Conger conger (European conger): 133139172 Help Entry 133139172         CDS       T10633                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ccog  Conger conger (European conger) Pathway ccog04519   Cadherin signaling ccog04810   Regulation of actin cytoskeleton ccog05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccog00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     133139172  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     133139172  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     133139172 SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil ABC_tran_CTD LXG DUF5617 Motif Other DBs NCBI-GeneID:  133139172 NCBI-ProteinID:  XP_061114523 LinkDB All DBs Position 10 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaggccaggaagatccagtgcagagagaaattcaccaggactgggcgaatcgggaa tatatcgaagttatcacgagcagtatcaagaaaattgcagattttttgaattcgttcgat atgtcctgcaggtctcgcctggcgactttgaatgaaaaactgacagcactggagaggaga attgaatatattgaagcaagggtaacaaaaggggagacattgacctag

DBGET integrated database retrieval system