Coprococcus comes: I6K69_11860 Help Entry I6K69_11860       CDS       T07118                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ccom  Coprococcus comes Brite KEGG Orthology (KO) [BR:ccom00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccom03032]     I6K69_11860    03036 Chromosome and associated proteins [BR:ccom03036]     I6K69_11860    03400 DNA repair and recombination proteins [BR:ccom03400]     I6K69_11860 DNA replication proteins [BR:ccom03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I6K69_11860 Chromosome and associated proteins [BR:ccom03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I6K69_11860 DNA repair and recombination proteins [BR:ccom03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I6K69_11860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 DUF2267 HU-CCDC81_euk_2 HU-DNA_bdg Transposase_mut UBA_HYPK A_thal_3526 DUF7342 Motif Other DBs NCBI-ProteinID:  QRT48954 LinkDB All DBs Position 2424586..2424861 Genome browser AA seq 91 aa AA seqDB search MNKTELVAAVAEQADISKKDAEKVLKAFVDVVTEEMKKGEKVQLVGFGTFEVSERAAREG RNPQTGKTMKIEACKAPKFKAGKALKDAVNA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaataagacagaattagtagctgcagttgcagaacaggcagatatttcaaagaaagat gcagaaaaagtattaaaagcatttgttgatgttgttacagaagaaatgaaaaaaggtgaa aaagttcagttagtaggattcggaactttcgaagtaagcgaaagagctgcaagagaagga agaaatccacagactggaaaaactatgaagatcgaagcttgcaaggctccgaaattcaaa gcaggaaaagctttaaaagatgctgttaatgcataa

DBGET integrated database retrieval system