Coprococcus comes: I6K69_16340
Help
Entry
I6K69_16340 CDS
T07118
Name
(GenBank) D-alanyl-D-alanine carboxypeptidase
KO
K07258
serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:
3.4.16.4
]
Organism
ccom
Coprococcus comes
Pathway
ccom00550
Peptidoglycan biosynthesis
ccom01100
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:
ccom00001
]
09100 Metabolism
09107 Glycan biosynthesis and metabolism
00550 Peptidoglycan biosynthesis
I6K69_16340
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
ccom01002
]
I6K69_16340
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
ccom01011
]
I6K69_16340
Enzymes [BR:
ccom01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.16 Serine-type carboxypeptidases
3.4.16.4 serine-type D-Ala-D-Ala carboxypeptidase
I6K69_16340
Peptidases and inhibitors [BR:
ccom01002
]
Serine peptidases
Family S11: D-Ala-D-Ala carboxypeptidase A family
I6K69_16340
Peptidoglycan biosynthesis and degradation proteins [BR:
ccom01011
]
Peptidoglycan biosynthesis and degradation
DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
I6K69_16340
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S11
PBP5_C
Motif
Other DBs
NCBI-ProteinID:
QRT51417
LinkDB
All DBs
Position
3370331..3371536
Genome browser
AA seq
401 aa
AA seq
DB search
METTQQKEPVSDAQTAQEKETREQERKQLLTRLYARSAALVDADSGRVLLGKEEHVMRPM
ASTTKIMTCILALEKGNPKDLVTASANAVAQPKVHLGMHEGEAFYLGDLLYSLMLESHND
SAVAIAEHLAGSVPQFAGWMNEKAEEIGCTEAHFVTPNGLDEEDVGGVHSISAADLAKIM
SYCVLRSPKAAEFLAITQMPAYSFSDAEGKGNFSCSNHNAFLQMMDGAISGKTGFTGDAG
YCYVGALQSEGRTFVVALLACGWPNNKNYKWTDTRKLMEYGMAHYRYAEVWKIPELSKIP
VENSVSKNGLFGKTAVEVEIKGKESPGKILVGDDDVAEEKTEVPEKLDAPVKSGTPVGQI
TYLLNGEKWGSCQAVVKETVRRRTFTWIAMKMCEMFYQFNF
NT seq
1206 nt
NT seq
+upstream
nt +downstream
nt
atggagactacgcagcaaaaggaaccggtctcggatgcacagactgcacaggaaaaagaa
acccgtgagcaggaaaggaagcagcttcttactcggctctatgcccgttccgctgcgctg
gtggatgcggacagcggcagggttctgctcggaaaagaagagcatgtaatgcgcccgatg
gcaagtacaacgaagatcatgacctgcattcttgcgctggaaaagggaaatccgaaggac
ctggtgacagcctctgcaaatgcggtcgcacagccgaaggttcatctgggaatgcacgaa
ggggaagcgttttatctgggggatcttctatattccctgatgctggaatcccataatgat
tctgcagtggcgatcgcggaacaccttgcaggatccgttccgcaatttgccgggtggatg
aatgaaaaggcagaagagatcggatgcactgaggcacattttgttacgccaaacggattg
gatgaagaggatgtgggcggtgtgcacagcatttcagctgcagatctggcaaaaatcatg
agctactgtgtcttgcgttctcccaaagctgcagaatttcttgcaatcacgcaaatgccg
gcatacagcttttctgatgctgagggaaaggggaattttagctgcagcaaccacaatgca
tttcttcagatgatggatggcgcgatttccgggaaaacagggtttaccggggatgccgga
tactgctatgtaggggctttgcagagtgagggccgcacatttgtagtggcactgcttgcc
tgtggctggccaaacaacaagaattataaatggacagataccagaaaactgatggagtac
ggaatggcacattatcgttatgctgaggtgtggaaaataccggagctttcgaaaataccc
gtggaaaacagtgtttccaaaaatggtttgtttggaaaaacagcagtggaagtggaaatc
aaaggaaaagaaagtccgggtaagattctggtcggagatgatgatgtggcagaagaaaag
acagaagtaccggaaaaactggatgcgccggtgaaaagcggaacaccggtcggacagatc
acgtatctcttaaacggggagaaatgggggagctgccaggctgttgtaaaagaaacagtc
agacggagaacatttacctggatagccatgaaaatgtgtgaaatgttttaccaatttaat
ttttaa
DBGET
integrated database retrieval system