Campylobacter corcagiensis: CCORG_0730 Help Entry CCORG_0730        CDS       T06832                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism ccor  Campylobacter corcagiensis Brite KEGG Orthology (KO) [BR:ccor00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccor03032]     CCORG_0730 (hup)    03036 Chromosome and associated proteins [BR:ccor03036]     CCORG_0730 (hup)    03400 DNA repair and recombination proteins [BR:ccor03400]     CCORG_0730 (hup) DNA replication proteins [BR:ccor03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CCORG_0730 (hup) Chromosome and associated proteins [BR:ccor03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CCORG_0730 (hup) DNA repair and recombination proteins [BR:ccor03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CCORG_0730 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  QKF64589 LinkDB All DBs Position complement(688855..689151) Genome browser AA seq 98 aa AA seqDB search MKKAEFIAAVAEKAGLTKKDTESVVDAALEVTKECLVNGDSISFIGFGSFDVATRAAREG KVPGTDKTYKSPATNVVKFKVGKQLKDAVAASKKIKKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaagctgaatttatagctgcagttgctgaaaaagctggtttaactaaaaaagat acagaaagtgttgttgatgcagccctagaagttacaaaagagtgcctagtaaatggtgac tcaattagctttataggttttggttcttttgatgttgctacaagagctgctagagagggt aaagttccaggaactgataaaacttacaaatctccagctacaaatgtagttaaatttaaa gttggtaaacaacttaaagatgcagttgctgcttcaaaaaagattaaaaagaaataa

DBGET integrated database retrieval system