Caulifigura coniformis: Pan44_24260 Help Entry Pan44_24260       CDS       T09806                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccos  Caulifigura coniformis Pathway ccos01100   Metabolic pathways ccos01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccos00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pan44_24260    00074 Mycolic acid biosynthesis     Pan44_24260   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pan44_24260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDT54393 UniProt:  A0A517SE43 LinkDB All DBs Position complement(2996295..2996552) Genome browser AA seq 85 aa AA seqDB search MAPADIRRVILNILERIAPDEDLSNLDDARPFREQMELDSMDFLDIVMELRKQYRIQIPE ADYPQLGTMDSTVAYLTPLLKDVQG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcgccggctgatattcgtcgagtgattctgaacattctggagcggatcgctcccgac gaagacctgtcgaatctcgacgatgcgcgcccgttccgcgaacagatggaactggacagc atggacttcctggacatcgtgatggaactgcggaagcagtatcgcatccagattccggaa gccgactatccgcagctaggcacgatggacagcaccgtcgcctacctgacgcccctgctg aaagacgtccagggctga

DBGET integrated database retrieval system