KEGG   Capsulimonas corticalis: CCAX7_009280
Entry
CCAX7_009280      CDS       T08728                                 
Symbol
cheY
Name
(GenBank) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
ccot  Capsulimonas corticalis
Pathway
ccot02020  Two-component system
ccot02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ccot00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CCAX7_009280 (cheY)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    CCAX7_009280 (cheY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ccot02022]
    CCAX7_009280 (cheY)
   02035 Bacterial motility proteins [BR:ccot02035]
    CCAX7_009280 (cheY)
Two-component system [BR:ccot02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   CCAX7_009280 (cheY)
Bacterial motility proteins [BR:ccot02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CCAX7_009280 (cheY)
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: BDI28877
UniProt: A0A402CU88
LinkDB
Position
complement(1120734..1121096)
AA seq 120 aa
MSKKILITDDALFMRVTLKNILVANGYEVVGEATNGQEAVDKYDAHQPDLVLMDITMPIM
DGITATRTIKGKHPAANVVMCTAMGQKNMVIEAIQAGAKDFIVKPFQPERVLESIKKLIG
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtcgaaaaaaatactgatcaccgatgacgctctgttcatgcgtgtcacactcaagaac
attctggtagccaatggctatgaggttgttggggaagccactaatggtcaggaagccgta
gacaagtatgacgcgcatcagccggacctcgtcctgatggacataaccatgcccatcatg
gacggaattacggcgacgcgcacgatcaagggcaagcacccggccgccaatgtcgtcatg
tgtaccgctatgggacagaaaaacatggtcattgaagcgatccaagccggagccaaggac
tttatcgtcaagccgtttcagccggaacgggtgctggaaagcatcaagaaactcatcgga
taa

DBGET integrated database retrieval system