Capsulimonas corticalis: CCAX7_12660 Help Entry CCAX7_12660       CDS       T08728                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism ccot  Capsulimonas corticalis Pathway ccot02020   Two-component system ccot02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ccot00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CCAX7_12660  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CCAX7_12660  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ccot02035]     CCAX7_12660 Bacterial motility proteins [BR:ccot02035]  Flagellar system   Flagellar assembly proteins    Others     CCAX7_12660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Spidroin_MaSp Motif Other DBs NCBI-ProteinID:  BDI29215 UniProt:  A0A402D4E3 LinkDB All DBs Position 1535945..1536205 Genome browser AA seq 86 aa AA seqDB search MTPAPRIAATPQNDSAGSTGTPAAEVELSSQAQTLASAMQAVDATPETRDDLVAKLQKQI SSGTYSVSGSDIADQMVRRAQADRIR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgacgcccgctcctcgcattgcggctacgccgcagaacgacagcgccggctccaccgga acaccggccgctgaagtagaactctcgtcgcaagcgcaaacgctcgcctccgccatgcag gcggtggacgcgacgcccgagacgcgagacgacttggtggcgaaactgcaaaagcagatt tcgtccggcacatacagcgtcagcggctccgatatcgctgatcaaatggtgcgccgcgcc caggctgatcgaatccgttaa

DBGET integrated database retrieval system