Capsulimonas corticalis: CCAX7_42920 Help Entry CCAX7_42920       CDS       T08728                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccot  Capsulimonas corticalis Pathway ccot01100   Metabolic pathways ccot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCAX7_42920 (acpP)    00074 Mycolic acid biosynthesis     CCAX7_42920 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCAX7_42920 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  BDI32241 UniProt:  A0A402CXJ9 LinkDB All DBs Position 5076011..5076244 Genome browser AA seq 77 aa AA seqDB search MSTFERVKKVVVEQLDVAEDEVTPQASFIDDLGADSLDVVELVMGLEEEFDVNIPDEDAE KITTVQEAVDYIDEKSK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcaacgttcgaacgtgtgaagaaggtagttgtggagcagctggatgtggctgaggac gaagtgaccccgcaggcgtcgtttatcgacgatctgggcgcggactccctcgacgtcgtc gagctggtcatggggctggaagaagagttcgacgtgaacattccggatgaagacgccgag aagatcacgacggtgcaggaagcggtcgattacatcgacgaaaagtccaagtaa

DBGET integrated database retrieval system