Corynebacterium coyleae: CCOY_05875
Help
Entry
CCOY_05875 CDS
T09177
Symbol
coaD
Name
(GenBank) Phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
ccoy
Corynebacterium coyleae
Pathway
ccoy00770
Pantothenate and CoA biosynthesis
ccoy01100
Metabolic pathways
ccoy01240
Biosynthesis of cofactors
Module
ccoy_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
ccoy00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
CCOY_05875 (coaD)
Enzymes [BR:
ccoy01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
CCOY_05875 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
DUF4884
Motif
Other DBs
NCBI-ProteinID:
WJY79781
LinkDB
All DBs
Position
1200450..1200929
Genome browser
AA seq
159 aa
AA seq
DB search
MTIAVCPGSFDPITNGHLDIVTRALRHFDEVIVLVTGNPTKTSGLFTIDERVDLIREATS
HLEGVRVDSWAGLLVDYTTQHDISALIKGLRSSLDYEYELPMAQMNRRLTGVDTYFLLTD
EKYGYISSSLTKEVAKYGGDISGLVPESVHDAIREKFSN
NT seq
480 nt
NT seq
+upstream
nt +downstream
nt
ttgaccatcgcagtctgccctggctcgttcgacccgatcacgaacgggcacctcgacatt
gtcacccgtgcccttcgtcatttcgacgaagtgatcgtgctggtcacaggcaaccctacg
aagacgtcggggctgtttactatcgacgagcgcgtcgacctcatccgcgaagccacctca
caccttgagggcgttcgcgtggatagctgggcgggcctattggtcgattacaccactcag
cacgacatcagcgcgctgattaagggcttgcgctcctcgctcgattacgagtacgaactg
ccgatggcacagatgaaccgacgcctgaccggcgtggatacctacttcctgctgacggat
gagaagtacggttacatctcgtcctcgctaaccaaagaggttgcgaagtacggcggtgac
atttccggactcgtgccggagagcgtccacgacgcgattcgggagaaattcagcaattga
DBGET
integrated database retrieval system