Corynebacterium coyleae: CCOY_11605
Help
Entry
CCOY_11605 CDS
T09177
Symbol
ssb2
Name
(GenBank) Single-stranded DNA-binding protein
KO
K03111
single-strand DNA-binding protein
Organism
ccoy
Corynebacterium coyleae
Pathway
ccoy03030
DNA replication
ccoy03430
Mismatch repair
ccoy03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
ccoy00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
CCOY_11605 (ssb2)
03430 Mismatch repair
CCOY_11605 (ssb2)
03440 Homologous recombination
CCOY_11605 (ssb2)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
ccoy03032
]
CCOY_11605 (ssb2)
03400 DNA repair and recombination proteins [BR:
ccoy03400
]
CCOY_11605 (ssb2)
03029 Mitochondrial biogenesis [BR:
ccoy03029
]
CCOY_11605 (ssb2)
DNA replication proteins [BR:
ccoy03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
CCOY_11605 (ssb2)
DNA repair and recombination proteins [BR:
ccoy03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
CCOY_11605 (ssb2)
TLS (translesion DNA synthesis) factors
Other SOS response factors
CCOY_11605 (ssb2)
Mitochondrial biogenesis [BR:
ccoy03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
CCOY_11605 (ssb2)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
tRNA_anti-codon
tRNA_anti_2
Motif
Other DBs
NCBI-ProteinID:
WJY80887
LinkDB
All DBs
Position
complement(2409837..2410463)
Genome browser
AA seq
208 aa
AA seq
DB search
MAQGDTPITVVGNLVADPELRFIPSGAAVANFRIASTPRTYNRETNQFEDGEALFLTCNC
WRQMAENVAESLTKGMRVVVTGKLKQRSYQTKEGENRTVFEVEVDEVGPSLKYATANVNR
NPREGGQGGYGGGQGNQGGGFGGQNQQQGGFNQGGFGGGQGNQGGGFGGQTQGQGQGGQN
QPQQPAHDPWGSAPEAGGFGGAGDEPPF
NT seq
627 nt
NT seq
+upstream
nt +downstream
nt
atggctcaaggcgataccccgattaccgttgtcggcaacttggttgctgacccggaactg
cgtttcatcccgagcggtgccgcggttgcgaacttccgcatcgcgtccaccccacgtacg
tataaccgggagacgaaccagttcgaggatggcgaagcactgtttctgacctgtaactgc
tggcgccagatggccgagaacgtcgcagagtccctgaccaagggcatgcgcgttgtggtc
accggcaagctcaagcagcgttcctaccaaactaaagagggcgaaaaccgcactgtgttc
gaggtcgaggtcgatgaggtcggcccgtccctgaagtacgccacggctaacgtcaaccgc
aacccgcgtgagggcgggcagggcggctacggcggcggccagggcaaccagggtggcggc
ttcggcggccagaaccagcagcagggcggctttaaccagggcggtttcggcggcggccaa
ggtaaccagggtggcggcttcggcggccaaacccagggccagggccaaggcggccagaac
cagccccagcagcctgcacatgatccgtggggttccgcacccgaggccggtggcttcggt
ggcgcgggcgatgagccaccgttctaa
DBGET
integrated database retrieval system