Chondrus crispus (carragheen): CHC_T00003331001 Help Entry CHC_T00003331001  CDS       T02916                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism ccp  Chondrus crispus (carragheen) Pathway ccp03020   RNA polymerase ccp03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ccp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CHC_T00003331001   09124 Replication and repair    03420 Nucleotide excision repair     CHC_T00003331001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ccp03021]     CHC_T00003331001    03400 DNA repair and recombination proteins [BR:ccp03400]     CHC_T00003331001 Transcription machinery [BR:ccp03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      CHC_T00003331001 DNA repair and recombination proteins [BR:ccp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CHC_T00003331001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  17322535 NCBI-ProteinID:  XP_005714822 UniProt:  R7QB84 LinkDB All DBs AA seq 127 aa AA seqDB search MASDLVHALTTNHLLFPIQHLVANSCSKRLEYVQDTKLYNSGTFKLEREDHTMGNLIRMQ LMRDPDVIFVGYKHPHPYEHHILLRVQTTTRPSVGGTYLPPDAFKTALQDLAAEVSTLSE QLRSQLH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggccagtgatttagtgcatgctctgacaacaaatcacctcctttttccaatacaacat cttgttgcaaactcgtgctcgaaaagactcgaatacgtccaggacacgaagctgtacaac tcgggaacattcaagctggagcgcgaggaccatacaatgggaaacttgatacgaatgcag ctaatgcgagatccagatgtcatattcgtgggctacaagcacccccatccttacgaacat cacatactgttacgagtacagacgacaacgaggccgtcagttggcgggacttacttaccg ccagatgcgtttaaaaccgcgctacaggatttggcggcagaagtctcgacgctgtcggaa caattgaggagccagctgcattaa

DBGET integrated database retrieval system