Chondrus crispus (carragheen): CHC_T00003568001 Help Entry CHC_T00003568001  CDS       T02916                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism ccp  Chondrus crispus (carragheen) Pathway ccp03060   Protein export ccp04141   Protein processing in endoplasmic reticulum ccp04145   Phagosome Brite KEGG Orthology (KO) [BR:ccp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CHC_T00003568001    04141 Protein processing in endoplasmic reticulum     CHC_T00003568001  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CHC_T00003568001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccp04131]     CHC_T00003568001   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ccp02044]     CHC_T00003568001 Membrane trafficking [BR:ccp04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     CHC_T00003568001 Secretion system [BR:ccp02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    CHC_T00003568001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  17322569 NCBI-ProteinID:  XP_005714843 UniProt:  R7QAF6 LinkDB All DBs AA seq 92 aa AA seqDB search MDAAKSVSEPLHGFMIDSVRLVRRCNKPDRKEFIKISSATAIGFAVMGFIGFFVRLIHIP VNSILLGKSRRVVDAIFCFYRFARAPSVDTIC NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggacgccgcaaagagcgtgagcgaacctctccacggctttatgattgattccgtgcgc cttgttcgtcggtgcaacaaaccagacaggaaagagtttatcaagatttcctcggccacc gccatcggcttcgccgtgatgggtttcatcggcttcttcgtgcgattgattcatattcca gtcaacagcattctactaggtaagtcacggagagtcgtggatgccatcttttgtttctac cgtttcgcgcgagccccatccgtcgacaccatttgctaa

DBGET integrated database retrieval system