Chondrus crispus (carragheen): CHC_T00005904001 Help Entry CHC_T00005904001  CDS       T02916                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism ccp  Chondrus crispus (carragheen) Brite KEGG Orthology (KO) [BR:ccp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ccp03041]     CHC_T00005904001   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccp04052]     CHC_T00005904001 Spliceosome [BR:ccp03041]  Complex B   Other components    Complex B specific factors     CHC_T00005904001 Cytokines and neuropeptides [BR:ccp04052]  Neuropeptides   Unclassified    CHC_T00005904001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Crinkler Ubiquitin_4 LRR_EndoS OTU1_UBXL CPDase Motif Other DBs NCBI-GeneID:  17325335 NCBI-ProteinID:  XP_005717619 UniProt:  R7QJ03 LinkDB All DBs AA seq 73 aa AA seqDB search MMEVVVSDRLGRRVRVKCEPDDTIGDLKKLIAAQVGTRPDKLKLQKWTIVYRDHITLADY EIQDGTGLELFYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatggaagtagtcgtcagcgaccgtctcggccgccgcgtgcgcgtcaaatgcgagccc gacgacaccatcggcgacctgaagaagctcattgctgcccaggtcggcacgcgacccgac aagctcaagctgcagaagtggaccattgtgtaccgtgaccacatcacgctggctgactac gaaatccaggacggtacaggcctcgaactattttatcaatag

DBGET integrated database retrieval system