KEGG   Campylobacter coli 15-537360: N149_0708
Entry
N149_0708         CDS       T02895                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
ccq  Campylobacter coli 15-537360
Pathway
ccq00770  Pantothenate and CoA biosynthesis
ccq01100  Metabolic pathways
ccq01240  Biosynthesis of cofactors
Module
ccq_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ccq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    N149_0708 (coaD)
Enzymes [BR:ccq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     N149_0708 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AGZ21164
LinkDB
Position
1016854..1017330
AA seq 158 aa
MTCLYPGTFDPITNGHLDVIKRALKIFDKVIVAIANSEHKKPCFSLEQRKELAKLATSHL
NNVEIITFDNLLVDLAKELKVNTIVRGLRAVSDFEYELQIGYANHALWEEIETIYLMPNL
KNAFISSSIVRSIASHGGDISTLVPKEILPFLKDLPCM
NT seq 477 nt   +upstreamnt  +downstreamnt
atgacttgtttatatccagggacttttgaccctattacaaatggacatttagatgtgatt
aaaagagcgcttaaaatctttgataaagtgattgtagctatagcaaatagcgagcataaa
aagccttgttttagcttagaacaaagaaaggagcttgcaaagcttgctacttcacattta
aacaatgtagaaattatcacttttgataatctccttgtagatttagccaaagagctcaaa
gtaaataccatagtaagaggacttagagcagtaagtgattttgaatacgaactacaaatt
ggctatgctaatcacgccctttgggaagagattgaaaccatttacctaatgccaaattta
aaaaatgcgtttatctcaagttctatagttagatctattgcttcccatggaggagatatc
agcactttagtccctaaagaaattttaccctttttaaaggatttgccttgtatgtag

DBGET integrated database retrieval system