Caulobacter vibrioides CB15: CC_0829 Help Entry CC_0829           CDS       T00049                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ccr  Caulobacter vibrioides CB15 Brite KEGG Orthology (KO) [BR:ccr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ccr03110]     CC_0829 Chaperones and folding catalysts [BR:ccr03110]  Protein folding catalysts   Protein disulfide isomerase    CC_0829 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 SH3BGR Reovirus_bridge Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AAK22814 UniProt:  Q9A9Y2 LinkDB All DBs Position complement(925723..925977) Genome browser AA seq 84 aa AA seqDB search MAKVTIYTRPFCPYCSRAVALLTDKGADFTEIEAGMDPALRQEMMQRSGRNTFPQIFVGE QHIGGCDDMMALEDQGKLDSLLSA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggccaaggtcaccatctacacccgccccttctgcccctactgctcgcgcgccgtggcg ctgctgaccgacaagggcgccgacttcaccgagatcgaggccggcatggatccggccctg cgccaggaaatgatgcagcgctcgggtcgcaacaccttcccgcagatcttcgtgggcgag cagcacatcggcggctgcgacgacatgatggccctggaagatcagggcaagctggacagc cttctgtcggcatga

DBGET integrated database retrieval system