Caulobacter vibrioides CB15: CC_1163 Help Entry CC_1163           CDS       T00049                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism ccr  Caulobacter vibrioides CB15 Pathway ccr01100   Metabolic pathways ccr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CC_1163    00074 Mycolic acid biosynthesis     CC_1163   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CC_1163 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAK23147 UniProt:  Q9A931 LinkDB All DBs Position complement(1321759..1322010) Genome browser AA seq 83 aa AA seqDB search MDTVTDLSLREIGVAATKVLGRAVEVRAESHIGRDLAVDSLALMNIIMELEDTFDISIPL DRLASVETAGDLSKLINDLRTRA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggatacggtgacggatctcagcctgcgcgagatcggggtagcggcgaccaaggttcta gggcgggctgtggaggttcgtgcggagtcgcatattggccgtgacctcgccgtcgattcc ctggccctcatgaacatcatcatggagctcgaagacaccttcgacatctccattccgctc gatcgcctggcgtccgtcgagaccgctggcgacctttccaaactgatcaacgatctccgg actagggcttaa

DBGET integrated database retrieval system