Caulobacter vibrioides CB15: CC_1677 Help Entry CC_1677           CDS       T00049                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccr  Caulobacter vibrioides CB15 Pathway ccr01100   Metabolic pathways ccr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CC_1677    00074 Mycolic acid biosynthesis     CC_1677   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CC_1677 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AAK23655 UniProt:  Q9A7P3 LinkDB All DBs Position 1851053..1851289 Genome browser AA seq 78 aa AA seqDB search MSDILERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFITEKTA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccgacattctcgagcgcgtgcgtaagatcgtcatcgagcacctggatgccgatccc gagaaggtcaccgagaaggcttccttcatcgacgacctgggcgccgacagcctcgacaac gttgagctggtgatggcgttcgaagaagagttcgacatcgaaatcccggacgacgccgcc gagcacatccaaacggtcggcgacgccgtgaagttcatcacggaaaagaccgcctaa

DBGET integrated database retrieval system