Colias croceus (clouded yellow): 123694951 Help Entry 123694951         CDS       T08651                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ccrc  Colias croceus (clouded yellow) Pathway ccrc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ccrc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     123694951  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccrc04121]     123694951    03400 DNA repair and recombination proteins [BR:ccrc03400]     123694951 Ubiquitin system [BR:ccrc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      123694951    Cul5 complex      123694951 DNA repair and recombination proteins [BR:ccrc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      123694951 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  123694951 NCBI-ProteinID:  XP_045496557 LinkDB All DBs Position 10 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVAPPSQMLFNKDSQLMEDEKTLAE YGLTSVTAKAQCPAPIGLALRKENGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcgaaaaaagttaaccatcttcacagatgcaaaggat acaacgactgtattagaactgaaaaaaatgattgaaggtattctgaaagtggcaccgccc agccaaatgttattcaacaaggacagtcagttgatggaggatgaaaagaccttagctgaa tatggtttgacctctgtgactgctaaagcacaatgccctgctcctatcggacttgctcta aggaaagaaaatggtgaatttgaagccctggatctgaccccatactcctcaccgccagac ctgccagacgtcatgaagtcccaggagacgaacggtcaagaacaaatggatcagcattaa

DBGET integrated database retrieval system