Colias croceus (clouded yellow): 123695872 Help Entry 123695872         CDS       T08651                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ccrc  Colias croceus (clouded yellow) Pathway ccrc04013   MAPK signaling pathway - fly ccrc04145   Phagosome ccrc04148   Efferocytosis ccrc04310   Wnt signaling pathway ccrc04620   Toll-like receptor signaling pathway ccrc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccrc00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     123695872    04310 Wnt signaling pathway     123695872  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123695872    04148 Efferocytosis     123695872  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123695872  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123695872  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccrc04131]     123695872   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccrc04147]     123695872    04031 GTP-binding proteins [BR:ccrc04031]     123695872 Membrane trafficking [BR:ccrc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123695872  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123695872   Macropinocytosis    Ras GTPases     123695872  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123695872 Exosome [BR:ccrc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123695872   Exosomal proteins of other body fluids (saliva and urine)    123695872   Exosomal proteins of colorectal cancer cells    123695872   Exosomal proteins of bladder cancer cells    123695872 GTP-binding proteins [BR:ccrc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123695872 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  123695872 NCBI-ProteinID:  XP_045497777 LinkDB All DBs Position 11:complement(3089070..3130988) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLAPITYPQGLSMAKEIGAVRYLECSALTQKGLKTVFDEAIRAVLCPV QPVKVKRKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgtgtcgtcgttggcgatggtgccgtcggtaaaacatgcctgctc atcagttacacaacaaatgccttccccggcgagtacatacctacagtattcgacaactac tcagcgaatgtgatggtagatggcaagccgatcaaccttggcctctgggataccgctggg caggaggactacgacaggctccgtccgctctcctacccgcaaacggacgtgttcctaata tgcttctcgctcgtcaacccggcttccttcgagaacgttcgggctaagtggtacccagaa gtgcggcatcactgtccgtcgacgcccatcatccttgtggggacgaagctcgacctgcgc gaagacaaggataccatcgaaaagttgaaggacaagaaactagctcccatcacctaccca cagggcctaagtatggcgaaggagatcggcgcggtgcggtatctagaatgttccgcgctc acgcagaagggcctcaagacggtgttcgacgaggcgatccgcgcggtgctgtgccccgtg cagcccgtcaaggtgaaacggaagtgcgtgctgctgtaa

DBGET integrated database retrieval system