Colias croceus (clouded yellow): 123695872 Help Entry 123695872         CDS       T08651                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ccrc  Colias croceus (clouded yellow) Pathway ccrc04013   MAPK signaling pathway - fly ccrc04145   Phagosome ccrc04148   Efferocytosis ccrc04310   Wnt signaling pathway ccrc04517   IgSF CAM signaling ccrc04518   Integrin signaling ccrc04620   Toll-like receptor signaling pathway ccrc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccrc00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     123695872    04310 Wnt signaling pathway     123695872   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123695872    04518 Integrin signaling     123695872  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123695872    04148 Efferocytosis     123695872  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123695872  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123695872  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccrc04131]     123695872   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccrc04147]     123695872    04031 GTP-binding proteins [BR:ccrc04031]     123695872 Membrane trafficking [BR:ccrc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123695872  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123695872   Macropinocytosis    Ras GTPases     123695872  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123695872 Exosome [BR:ccrc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123695872   Exosomal proteins of other body fluids (saliva and urine)    123695872   Exosomal proteins of colorectal cancer cells    123695872   Exosomal proteins of bladder cancer cells    123695872 GTP-binding proteins [BR:ccrc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123695872 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  123695872 NCBI-ProteinID:  XP_045497777 LinkDB All DBs Position 11:complement(3089070..3130988) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLAPITYPQGLSMAKEIGAVRYLECSALTQKGLKTVFDEAIRAVLCPV QPVKVKRKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgtgtcgtcgttggcgatggtgccgtcggtaaaacatgcctgctc atcagttacacaacaaatgccttccccggcgagtacatacctacagtattcgacaactac tcagcgaatgtgatggtagatggcaagccgatcaaccttggcctctgggataccgctggg caggaggactacgacaggctccgtccgctctcctacccgcaaacggacgtgttcctaata tgcttctcgctcgtcaacccggcttccttcgagaacgttcgggctaagtggtacccagaa gtgcggcatcactgtccgtcgacgcccatcatccttgtggggacgaagctcgacctgcgc gaagacaaggataccatcgaaaagttgaaggacaagaaactagctcccatcacctaccca cagggcctaagtatggcgaaggagatcggcgcggtgcggtatctagaatgttccgcgctc acgcagaagggcctcaagacggtgttcgacgaggcgatccgcgcggtgctgtgccccgtg cagcccgtcaaggtgaaacggaagtgcgtgctgctgtaa

DBGET integrated database retrieval system