Colias croceus (clouded yellow): 123699656 Help Entry 123699656         CDS       T08651                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ccrc  Colias croceus (clouded yellow) Pathway ccrc04137   Mitophagy - animal ccrc04140   Autophagy - animal ccrc04144   Endocytosis ccrc04145   Phagosome ccrc04148   Efferocytosis Brite KEGG Orthology (KO) [BR:ccrc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123699656    04145 Phagosome     123699656    04140 Autophagy - animal     123699656    04137 Mitophagy - animal     123699656    04148 Efferocytosis     123699656  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccrc04131]     123699656   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccrc04147]     123699656    04031 GTP-binding proteins [BR:ccrc04031]     123699656 Membrane trafficking [BR:ccrc04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     123699656 Exosome [BR:ccrc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123699656   Exosomal proteins of other body fluids (saliva and urine)    123699656   Exosomal proteins of colorectal cancer cells    123699656   Exosomal proteins of bladder cancer cells    123699656 GTP-binding proteins [BR:ccrc04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     123699656 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 cobW Septin AAA_16 AAA_24 PduV-EutP AAA_22 NACHT AAA_7 AAA_5 ATPase_2 G-alpha NTPase_1 SRPRB ABC_tran AAA_14 ATP-synt_ab NB-ARC TniB RNA_helicase PRK DAP3 Motif Other DBs NCBI-GeneID:  123699656 NCBI-ProteinID:  XP_045502619 LinkDB All DBs Position 2:complement(5174734..5176596) Genome browser AA seq 208 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPENFPF VILGNKVDLDNRAVSAKRAQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNGRNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcacgaaaaaaggtccttttgaaggtaatcattttgggtgacagtggagtcggg aaaacttcgctaatgaatcagtttgtcaacaagaaattttccaatcagtacaaggctaca ataggcgcagattttctcacgaaggaggtaatcgttgacgatagaattgtcacaatgcaa atttgggacactgctggtcaagagcgtttccagtcattgggggtggcgttctatcgtggg gcggattgttgcgtattagtgtttgacgtaacggccccgaacacgttcaagtccttggag agttggcgagatgaatttctgatacaggcgtcgcctcgtgacccggagaacttccccttt gtgatcctaggtaataaagtggatttggataatcgtgccgtttcagctaaacgagcccag caatggtgtcaaagcaaaaatgatatcccatattttgaaaccagtgccaaagaagctgtg aacgtagagctagcattccaaaccatagcacgcaatgctctagcccaagagaccgaagct gaactctacaacgagtttccagatcagatcaaattaaatgccaatgacaatggtcgcaac agagatggagataactgtgcttgttag

DBGET integrated database retrieval system