Colias croceus (clouded yellow): 123703267 Help Entry 123703267         CDS       T08651                                  Name (RefSeq) eclosion hormone-like   KO K28249   eclosion hormone Organism ccrc  Colias croceus (clouded yellow) Brite KEGG Orthology (KO) [BR:ccrc00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccrc04052]     123703267 Cytokines and neuropeptides [BR:ccrc04052]  Neuropeptides   Unclassified    123703267 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Eclosion Motif Other DBs NCBI-GeneID:  123703267 NCBI-ProteinID:  XP_045507169 LinkDB All DBs Position 25:823433..823690 Genome browser AA seq 83 aa AA seqDB search MSAKLAAIFALVAVAASLVEGNPSIVTGYDHLELCIENCAQCKKTLGAWFDGPLCADSCL KFRGKLIPDCEDVASIAPFLTKI NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtccgccaagctcgcagccatattcgcgcttgttgcagtcgcagcgagcctcgtcgag ggcaatccttctatcgtcactggatacgaccacttggagttgtgcattgagaattgtgct caatgcaagaagacgctcggagcgtggttcgacggcccactgtgtgcggactcttgcctc aagttcagagggaagctgatccccgactgcgaggacgtagcctccattgcaccctttctc accaagatttaa

DBGET integrated database retrieval system