Colias croceus (clouded yellow): 123703643 Help Entry 123703643         CDS       T08651                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism ccrc  Colias croceus (clouded yellow) Pathway ccrc03030   DNA replication ccrc03082   ATP-dependent chromatin remodeling ccrc03410   Base excision repair ccrc03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ccrc00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     123703643    03410 Base excision repair     123703643    03420 Nucleotide excision repair     123703643   09126 Chromosome    03082 ATP-dependent chromatin remodeling     123703643  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccrc03032]     123703643    03036 Chromosome and associated proteins [BR:ccrc03036]     123703643    03400 DNA repair and recombination proteins [BR:ccrc03400]     123703643 Enzymes [BR:ccrc01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      123703643 DNA replication proteins [BR:ccrc03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     123703643 Chromosome and associated proteins [BR:ccrc03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     123703643 DNA repair and recombination proteins [BR:ccrc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       123703643 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone NYAP_C TAF Motif Other DBs NCBI-GeneID:  123703643 NCBI-ProteinID:  XP_045507674 LinkDB All DBs Position 27:5851421..5851982 Genome browser AA seq 119 aa AA seqDB search MAEKLEDLNLPLTVVTRIVKEALPEGVSISKEARTGLAKAASVFVLYVTSAATNIVKNHK RKALTGQDVLEAMADIEFDRFMEPLRDALEQYKITAFAKKTAAGKKKDEEDVEMVEEDE NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaaactcgaagatttaaatttaccgctcacagtggtcacacgaatcgtcaaa gaggctttgcccgaaggagtatctatatcgaaagaggcgcgaacgggtttggccaaagct gcctctgtttttgtactatacgtgacttctgcggctactaatattgttaagaaccataaa aggaaagctttaaccggccaggatgtgttggaagcgatggctgacatagagtttgataga ttcatggagcctctaagagatgccttagaacaatacaagattacggctttcgccaaaaaa actgctgctggcaagaagaaggacgaagaagatgtagaaatggttgaagaagatgaataa

DBGET integrated database retrieval system