Colias croceus (clouded yellow): 123705155 Help Entry 123705155         CDS       T08651                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism ccrc  Colias croceus (clouded yellow) Pathway ccrc04144   Endocytosis ccrc04517   IgSF CAM signaling ccrc04518   Integrin signaling ccrc04519   Cadherin signaling ccrc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccrc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123705155    04518 Integrin signaling     123705155    04519 Cadherin signaling     123705155  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123705155  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123705155  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccrc04131]     123705155    03036 Chromosome and associated proteins [BR:ccrc03036]     123705155   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccrc04147]     123705155    04031 GTP-binding proteins [BR:ccrc04031]     123705155 Membrane trafficking [BR:ccrc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123705155  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     123705155   Macropinocytosis    Ras GTPases     123705155 Chromosome and associated proteins [BR:ccrc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     123705155 Exosome [BR:ccrc04147]  Exosomal proteins   Exosomal proteins of microglial cells    123705155   Exosomal proteins of breast milk    123705155 GTP-binding proteins [BR:ccrc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123705155 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  123705155 NCBI-ProteinID:  XP_045509770 LinkDB All DBs Position Z Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHQQKTPFLLVGTQIDLR DDPGTMEKLAKIKQKPVSLEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVKRRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccattaagtgtgttgttgtgggtgatggtgcggtcggtaagacctgcctgctc atcagctacaccacaaataaattcccatcggaatatgtacccactgtatttgacaattat gcagtgactgtcatgattggtggtgaaccttacactctgggtctctttgatactgcgggt caggaagattatgacaggctgagaccactaagttatccacaaactgacgttttccttgtt tgcttcagtgttgtgagtcccagttcctttgaaaatgttaaggaaaagtgggtccctgaa ataactcatcatcagcaaaagactccgttcctgttggttgggacacaaatagatttaaga gatgaccctggcaccatggaaaagttggcgaagatcaaacagaaaccagtgtctctggag caaggagagaaacttgcaaaggaactgaaagctgttaaatatgtggagtgctctgcttta actcagaaagggctaaagaacgtattcgacgaggcaattctggcggctctggagcctccg gagcccgtgaagagaaggaaatgcgtgttgctgtaa

DBGET integrated database retrieval system