Cariama cristata (Red-legged seriema): 104154858 Help Entry 104154858         CDS       T08341                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism ccri  Cariama cristata (Red-legged seriema) Brite KEGG Orthology (KO) [BR:ccri00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ccri01002]     104154858 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccri04147]     104154858 (CSTB) Peptidases and inhibitors [BR:ccri01002]  Peptidase inhibitors   Family I25: cystatin family    104154858 (CSTB) Exosome [BR:ccri04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104154858 (CSTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin SQAPI Dynein_light AAA_lid_NAV1 Motif Other DBs NCBI-GeneID:  104154858 NCBI-ProteinID:  XP_009698705 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search VKPQLEEKEGRTFDVFTAVEFKTQVVAGTNYFIKVHVGNDKFMHLRVFRSLPHENKPLSL HSYQSSKTKHDELAFF NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtaaaacctcagctggaagaaaaagaagggagaacctttgatgtcttcactgcagtggag tttaaaactcaggtggttgctggaacaaactacttcatcaaggtccatgttggcaatgat aagttcatgcacctgcgggtgttcagaagccttcctcacgagaataagccgctgagtctc cacagttaccagagcagcaagactaagcacgatgaactggcttttttctag

DBGET integrated database retrieval system