Cariama cristata (Red-legged seriema): 104156287 Help Entry 104156287         CDS       T08341                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri04010   MAPK signaling pathway ccri04012   ErbB signaling pathway ccri04068   FoxO signaling pathway ccri04137   Mitophagy - animal ccri04140   Autophagy - animal ccri04150   mTOR signaling pathway ccri04210   Apoptosis ccri04218   Cellular senescence ccri04370   VEGF signaling pathway ccri04371   Apelin signaling pathway ccri04540   Gap junction ccri04625   C-type lectin receptor signaling pathway ccri04810   Regulation of actin cytoskeleton ccri04910   Insulin signaling pathway ccri04912   GnRH signaling pathway ccri04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ccri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104156287 (NRAS)    04012 ErbB signaling pathway     104156287 (NRAS)    04370 VEGF signaling pathway     104156287 (NRAS)    04371 Apelin signaling pathway     104156287 (NRAS)    04068 FoxO signaling pathway     104156287 (NRAS)    04150 mTOR signaling pathway     104156287 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104156287 (NRAS)    04137 Mitophagy - animal     104156287 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104156287 (NRAS)    04218 Cellular senescence     104156287 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104156287 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104156287 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104156287 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104156287 (NRAS)    04912 GnRH signaling pathway     104156287 (NRAS)    04916 Melanogenesis     104156287 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccri04131]     104156287 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccri04147]     104156287 (NRAS)    04031 GTP-binding proteins [BR:ccri04031]     104156287 (NRAS) Membrane trafficking [BR:ccri04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104156287 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104156287 (NRAS) Exosome [BR:ccri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104156287 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104156287 (NRAS)   Exosomal proteins of breast cancer cells    104156287 (NRAS)   Exosomal proteins of colorectal cancer cells    104156287 (NRAS) GTP-binding proteins [BR:ccri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104156287 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  104156287 NCBI-ProteinID:  XP_009701534 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search LQDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINL YREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDA FYTLVREIRQYRMKKLNSNEDGNQGCMGLSCIVM NT seq 465 nt NT seq  +upstreamnt  +downstreamnt ttgcaggattcttatagaaagcaggttgttattgatggtgagacgtgcttgttagacatt ctggacactgcgggacaggaagagtatagtgccatgcgtgatcagtacatgagaactggg gaaggattcctctgtgtttttgccattaacaacagtaaatcgtttgctgatattaacctt tacagagaacagatcaagagagtgaaagactcggatgatgtgccaatggtgctagttggg aataagtgtgatttgcccacaagaacagtagacacaaaacaggctcaagaattagcaaaa agctatggaatccccttcatagagacatctgctaaaacaagacagggtgtggaagatgct ttttacacactggtgagagagatccggcagtaccggatgaaaaaactcaacagcaatgaa gatgggaatcaaggctgtatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system