Cariama cristata (Red-legged seriema): 104156762 Help Entry 104156762         CDS       T08341                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri04810   Regulation of actin cytoskeleton ccri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccri00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104156762 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104156762 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccri04131]     104156762 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccri04812]     104156762 (PFN2)    04147 Exosome [BR:ccri04147]     104156762 (PFN2) Membrane trafficking [BR:ccri04131]  Others   Actin-binding proteins    Others     104156762 (PFN2) Cytoskeleton proteins [BR:ccri04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104156762 (PFN2) Exosome [BR:ccri04147]  Exosomal proteins   Proteins found in most exosomes    104156762 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104156762 NCBI-ProteinID:  XP_009700446 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search PVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVG RAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ccagtagaaatagatatgatcgtaggaaaagaccgagagggtttcttcaccaatggtctg acccttggtgcaaagaagtgctctgtgatcagagatagcctgtatgttgatggtgactgc acaatggacatcaggacaaagagtcaaggtggtgagccaacgtacaatgttgctgtaggc agagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggcggattg aataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system