Cariama cristata (Red-legged seriema): 104156769 Help Entry 104156769         CDS       T08341                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri04814   Motor proteins ccri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccri00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     104156769 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104156769 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccri03037]     104156769 (DYNLT3)    04812 Cytoskeleton proteins [BR:ccri04812]     104156769 (DYNLT3) Cilium and associated proteins [BR:ccri03037]  Motile cilia and associated proteins   Dynein arm    104156769 (DYNLT3) Cytoskeleton proteins [BR:ccri04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104156769 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  104156769 NCBI-ProteinID:  XP_009697607 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MIFNADEAHNIVKECIENVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGKTYKYIVTCAV MQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgatcttcaatgctgatgaggcccacaacatagttaaggagtgcatagaaaatgtttta ggcaaggcagattataatcacaacaaagtcaaccaatggactgctgctatagtagaacag tcgctgacacatctggtaaaacttggaaaaacatataagtacatcgtaacctgtgctgtg atgcagaggagtggagctggtcttcacacagcaagctcatgcttctgggataccacaact gatggaacctgcacagtgagatgggaaaaccgaacaatgaactgcattgtcaatgtgttt gctgttgctattatcctgtag

DBGET integrated database retrieval system