Cariama cristata (Red-legged seriema): 104157865 Help Entry 104157865         CDS       T08341                                  Name (RefSeq) beta-2-microglobulin-like   KO K08055   beta-2-microglobulin Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ccri00001]  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     104157865  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccri04147]     104157865 Exosome [BR:ccri04147]  Exosomal proteins   Exosomal proteins of breast milk    104157865 SSDB OrthologParalogGFIT Motif Pfam:  C1-set Ig_2 C2-set_2 Ig_3 I-set ig Motif Other DBs NCBI-GeneID:  104157865 NCBI-ProteinID:  XP_009693671 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search LLTAPLPSSPEAPKVQVYSRKHASFGEENVLNCFVSGFHPPKIEIALLKNGEPMSGVKYT DMSFNEKWFFERLAYAPFTPQKGDVYTCRVTHSAFKEPQSFRWDADF NT seq 324 nt NT seq  +upstreamnt  +downstreamnt cttctcactgcccccttaccctcctctccagaggcgccgaaggtgcaggtgtactcccgc aaacatgcctccttcggagaggaaaacgtcctcaactgcttcgtgagtggtttccaccct ccgaagattgagatcgccctcctcaagaacggggaacccatgagtggtgtgaagtacacg gacatgtccttcaacgagaagtggttttttgagcgcttggcgtatgcgccgttcaccccc cagaagggcgatgtctacacttgcagggtgacccactctgccttcaaagagccacagtct ttcagatgggatgcggacttctaa

DBGET integrated database retrieval system