Cariama cristata (Red-legged seriema): 104158389 Help Entry 104158389         CDS       T08341                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri04010   MAPK signaling pathway ccri04012   ErbB signaling pathway ccri04068   FoxO signaling pathway ccri04137   Mitophagy - animal ccri04140   Autophagy - animal ccri04144   Endocytosis ccri04150   mTOR signaling pathway ccri04210   Apoptosis ccri04218   Cellular senescence ccri04370   VEGF signaling pathway ccri04371   Apelin signaling pathway ccri04510   Focal adhesion ccri04540   Gap junction ccri04625   C-type lectin receptor signaling pathway ccri04810   Regulation of actin cytoskeleton ccri04910   Insulin signaling pathway ccri04912   GnRH signaling pathway ccri04916   Melanogenesis ccri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104158389 (HRAS)    04012 ErbB signaling pathway     104158389 (HRAS)    04370 VEGF signaling pathway     104158389 (HRAS)    04371 Apelin signaling pathway     104158389 (HRAS)    04068 FoxO signaling pathway     104158389 (HRAS)    04150 mTOR signaling pathway     104158389 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104158389 (HRAS)    04140 Autophagy - animal     104158389 (HRAS)    04137 Mitophagy - animal     104158389 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104158389 (HRAS)    04218 Cellular senescence     104158389 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104158389 (HRAS)    04540 Gap junction     104158389 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104158389 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104158389 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104158389 (HRAS)    04912 GnRH signaling pathway     104158389 (HRAS)    04916 Melanogenesis     104158389 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104158389 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccri04131]     104158389 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccri04147]     104158389 (HRAS)    04031 GTP-binding proteins [BR:ccri04031]     104158389 (HRAS) Membrane trafficking [BR:ccri04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104158389 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104158389 (HRAS) Exosome [BR:ccri04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104158389 (HRAS)   Exosomal proteins of colorectal cancer cells    104158389 (HRAS) GTP-binding proteins [BR:ccri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104158389 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  104158389 NCBI-ProteinID:  XP_009694320 UniProt:  A0A091LUW7 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtgggagctggtggtgttgggaagagtgctttgacg atacagctcattcagaaccattttgttgatgagtatgaccccacgatagaggattcctac agaaagcaggttgtcatcgatggagagacctgcttgttagacatcttggataccgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgc gtcttcgccatcaataacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagcccggacagtggagacccggcaagcgcaggatttggcccggagttatgggatcccc tacatagaaacgtctgccaaaaccagacagggagttgaagatgccttctacaccttggtg cgggagatccgtcagcacaagctgcgtaaactgaatcccccagatgagagcggccccggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system