Cariama cristata (Red-legged seriema): 104159856 Help Entry 104159856         CDS       T08341                                  Symbol TMEM218 Name (RefSeq) transmembrane protein 218   KO K26674   transmembrane protein 218 Organism ccri  Cariama cristata (Red-legged seriema) Brite KEGG Orthology (KO) [BR:ccri00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccri03037]     104159856 (TMEM218) Cilium and associated proteins [BR:ccri03037]  Primary cilia and associated proteins   MKS complex    104159856 (TMEM218) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  104159856 NCBI-ProteinID:  XP_009696175 LinkDB All DBs Position Unknown AA seq 44 aa AA seqDB search IVDTFFIGRFVLLAVMSLVLLGCLFLLLIYHLMEPVYAKPLHGS NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atcgtggacaccttctttatcggtcgctttgtcctcctggctgtgatgagcctggtctta cttgggtgcctgttcctgctcctgatttaccacctcatggagccggtgtatgccaaaccg ctccatggcagctag

DBGET integrated database retrieval system