Cariama cristata (Red-legged seriema): 104160314 Help Entry 104160314         CDS       T08341                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism ccri  Cariama cristata (Red-legged seriema) Brite KEGG Orthology (KO) [BR:ccri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccri03036]     104160314   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccri04147]     104160314 Chromosome and associated proteins [BR:ccri03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104160314 Exosome [BR:ccri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104160314 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104160314 NCBI-ProteinID:  XP_009696710 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVG LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 283 nt NT seq  +upstreamnt  +downstreamnt gccgggtaccgtggctcttcgtgaaatcagacgctatcaaaagtcgaccgaacttttgat ccgcaaacttcccttccagcgtctggtgcgtgaaattgctcaggatttcaagacagatct gcgcttccagagcgctgccatcggtgctttgcaggaggcaagtgaagcctacttggttgg cctgtttgaagataccaacctgtgtgctatccatgccaaacgtgtcacaatcatgccaaa agatatccagctagcacgccgcatacgtggagagcgtgcctaa

DBGET integrated database retrieval system