Cariama cristata (Red-legged seriema): 104162630 Help Entry 104162630         CDS       T08341                                  Symbol MORN4 Name (RefSeq) MORN repeat-containing protein 4   KO K25701   MORN repeat-containing protein 4 Organism ccri  Cariama cristata (Red-legged seriema) Brite KEGG Orthology (KO) [BR:ccri00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccri03037]     104162630 (MORN4) Cilium and associated proteins [BR:ccri03037]  Other cilia and associated proteins   Stereociliary proteins    104162630 (MORN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MORN HCBP_related Motif Other DBs NCBI-GeneID:  104162630 NCBI-ProteinID:  XP_009699704 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MTLTKGSFTYSNGEEYRGEWKEGRRHGVGQLTFADGTAYVGHFENGLFHGCGVLTFSDGS RYEGEFVQGKFNGVGIFTRCDKMTF NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccctcaccaaaggctccttcacctactccaacggggaggagtaccgcggcgagtgg aaggaaggtcgcaggcacggtgttgggcagctgacatttgctgacggcaccgcttacgtg gggcactttgagaacgggctcttccatggctgcggtgtgcttaccttctccgacggctcc aggtacgagggggagtttgtgcagggcaagttcaatggcgtcggcatcttcacccgctgc gacaagatgaccttt

DBGET integrated database retrieval system