Cariama cristata (Red-legged seriema): 104166856 Help Entry 104166856         CDS       T08341                                  Name (RefSeq) histone H2B, gonadal-like   KO K11252   histone H2B Organism ccri  Cariama cristata (Red-legged seriema) Brite KEGG Orthology (KO) [BR:ccri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccri03036]     104166856   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccri04147]     104166856 Chromosome and associated proteins [BR:ccri03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104166856 Exosome [BR:ccri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104166856 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  104166856 NCBI-ProteinID:  XP_009705249 LinkDB All DBs Position Unknown AA seq 65 aa AA seqDB search MSAEAGRKRGRAPAPASGDRKPKRKPKRRETYSVYIYKVLKQVHPDTGISSKAMSIMNSF VNDIF NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgagtgcggaggctgggaggaagcgtggtcgtgctcctgctcctgcctctggggacagg aagcctaagaggaaacctaagagaagggaaacctattcagtctatatctacaaagtactg aagcaggtgcacccggacaccggcatctcctctaaggccatgagcatcatgaactccttc gtcaacgacatcttt

DBGET integrated database retrieval system