Cariama cristata (Red-legged seriema): 104168146 Help Entry 104168146         CDS       T08341                                  Symbol CAV1 Name (RefSeq) caveolin-1   KO K06278   caveolin 1 Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri04144   Endocytosis ccri04510   Focal adhesion ccri05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccri00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104168146 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104168146 (CAV1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     104168146 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccri04131]     104168146 (CAV1) Membrane trafficking [BR:ccri04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     104168146 (CAV1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  104168146 NCBI-ProteinID:  XP_009706925 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search IDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSAIFGIPMALIWGIYFAILSFL HIWAVVPCIRSYLIEIQCISRVYSICIHTFCDPLFEAIGKMFSSIRATVRKEI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt attgattttgaagatgtgattgctgagccagagggaacacacagctttgatgggatttgg aaggccagttttaccaccttcactgtaacgaaatactggttttatcgtttactgtcagca atctttggcattcctatggctctcatctggggcatctactttgccattttgtcattcctg cacatctgggcggtggtgccatgcataaggagctacctgattgagatccagtgcattagc cgcgtctattcgatctgcatccacacattctgcgacccactgttcgaggccataggcaaa atgttcagcagcatccgagccacagtacggaaagagatttga

DBGET integrated database retrieval system