Cariama cristata (Red-legged seriema): 104168160
Help
Entry
104168160 CDS
T08341
Symbol
CCNH
Name
(RefSeq) cyclin-H
KO
K06634
cyclin H
Organism
ccri
Cariama cristata (Red-legged seriema)
Pathway
ccri03022
Basal transcription factors
ccri03420
Nucleotide excision repair
ccri04110
Cell cycle
Brite
KEGG Orthology (KO) [BR:
ccri00001
]
09120 Genetic Information Processing
09121 Transcription
03022 Basal transcription factors
104168160 (CCNH)
09124 Replication and repair
03420 Nucleotide excision repair
104168160 (CCNH)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
104168160 (CCNH)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:
ccri03021
]
104168160 (CCNH)
03400 DNA repair and recombination proteins [BR:
ccri03400
]
104168160 (CCNH)
Transcription machinery [BR:
ccri03021
]
Eukaryotic type
RNA polymerase II system
Basal transcription factors
TFIIH
104168160 (CCNH)
DNA repair and recombination proteins [BR:
ccri03400
]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TFIIH complex
104168160 (CCNH)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Cyclin_C_2
Cyclin_N
CycT2-like_C
Motif
Other DBs
NCBI-GeneID:
104168160
NCBI-ProteinID:
XP_009706943
LinkDB
All DBs
Position
Unknown
AA seq
200 aa
AA seq
DB search
MAICKYYEKRLLDFCAVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLAC
KVDEFNVSSAQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLID
LKTRYPMLENPEVLRKTADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGINMESYLS
ESLMLKENGTSLAKLLDGMK
NT seq
601 nt
NT seq
+upstream
nt +downstream
nt
atggcgatatgcaaatactacgaaaagcggttgctggacttctgcgccgtcttcaagcct
gccatgccgagatccgtggtgggaacagcttgcatgtatttcaaacgcttttacctcaat
aactcagtgatggagtatcatcctcggataataatgctaacatgtgcatttttggcctgt
aaagtagatgaatttaacgtgtccagtgcacagtttgttggtaaccttcgagaaagccct
cttggacaggaaaaagctcttgagcaaatactggaatatgaactcctgcttattcagcaa
ctgaacttccatcttatcgttcacaatccatacaggccatttgagggatttctaattgat
ttgaagactcgctatccaatgctggaaaatcccgaagttttgaggaaaacagctgatgac
ttcctcaatcgagtggctctgacagatgcctatctgctctttactccctcacagatagct
ctcactgctatattgtctagtggttcaagagcaggaattaatatggaaagttatttatca
gaaagtcttatgctgaaagaaaacggaacatccttagccaagctactggatggcatgaaa
g
DBGET
integrated database retrieval system