Chrysoperla carnea: 123296989 Help Entry 123296989         CDS       T09255                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ccrn  Chrysoperla carnea Pathway ccrn04013   MAPK signaling pathway - fly ccrn04145   Phagosome ccrn04148   Efferocytosis ccrn04310   Wnt signaling pathway ccrn04517   IgSF CAM signaling ccrn04518   Integrin signaling ccrn04620   Toll-like receptor signaling pathway ccrn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccrn00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     123296989    04310 Wnt signaling pathway     123296989   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     123296989    04518 Integrin signaling     123296989  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123296989    04148 Efferocytosis     123296989  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123296989  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     123296989  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccrn04131]     123296989   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccrn04147]     123296989    04031 GTP-binding proteins [BR:ccrn04031]     123296989 Membrane trafficking [BR:ccrn04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     123296989  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     123296989   Macropinocytosis    Ras GTPases     123296989  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     123296989 Exosome [BR:ccrn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123296989   Exosomal proteins of other body fluids (saliva and urine)    123296989   Exosomal proteins of colorectal cancer cells    123296989   Exosomal proteins of bladder cancer cells    123296989 GTP-binding proteins [BR:ccrn04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     123296989 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  123296989 NCBI-ProteinID:  XP_044734665 LinkDB All DBs Position 3:complement(64596131..64602033) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLSPITYPQGLAMAKEISAVKYLECSALTQKGLKTVFDEAIRAVLCPV QHVKPKRRCQIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcaattaaatgtgttgttgttggtgatggtgccgtgggtaaaacatgcttattg ataagttatacaacaaatgcattccctggggaatatattccaacagtatttgataattat tcagcgaatgttatggtcgatggtaagccaattaatctcggactatgggatacagctgga caagaagattatgaccgtttacgacctctttcatacccacaaactgatgtatttcttata tgtttctcgttagtaaatccagcttcatttgaaaacgttcgagcaaagtggtatcctgaa gttcgccatcattgtcctagtacaccaattattcttgtcggaactaaattggatttacgt gaggataaagatacaattgaaaaattgaaagataaaaaattatcacctattacttacccc caaggtttagcaatggctaaagaaattagtgcagttaaatatttggaatgttcagcatta acacaaaaaggattaaaaacagtgttcgatgaagcaattcgtgcagttttatgtccagta caacatgtgaagccgaagcgacggtgtcaaattctatag

DBGET integrated database retrieval system